SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|82198 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|82198
Domain Number 1 Region: 53-100
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.25e-17
Family Ovomucoid domain III-like 0.0075
Further Details:      
 
Domain Number 2 Region: 107-153
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000596
Family Ovomucoid domain III-like 0.0052
Further Details:      
 
Domain Number 3 Region: 2-47
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000333
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 4 Region: 156-201
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000568
Family Ovomucoid domain III-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|82198
Sequence length 201
Sequence
MKCDMACQFNYDPVCGSDGRTYSNECQLQSLNCGKALRVEMVMKGECEKVKELRECAIPC
FRMYDPVCGSDGVTYGNECEMRTESCLKKQEISIAHAGECQAQPELESCAIPCQPLRQPV
CGSDGVTYWNKCELETENCMKKASVEVMYDGECLEDCNIPCHFNLDPVCAEDGVTYTNKC
YLETRNCLAKEFLKVVHQGSC
Download sequence
Identical sequences T1G4P1
XP_009020769.1.102002 jgi|Helro1|82198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]