SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|82429 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|82429
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily vWA-like 0.0000751
Family Integrin A (or I) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|82429
Sequence length 101
Sequence
MAHQLLIIVSDGRIQENVGRVKPYVKLATERGIFIVFIIVDTKSSILSIRNPIVDERQQI
RLEPYMDSFPFPYYVIIRDVTNIPQTMADALRQWFELVGQK
Download sequence
Identical sequences T1G4S0
jgi|Helro1|82429 XP_009021079.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]