SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|83197 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|83197
Domain Number 1 Region: 46-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000809
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 2 Region: 1-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000251
Family Laminin-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|83197
Sequence length 98
Sequence
CNCNEKGVVTNECNENGQCNCKPNYVGQACDQCAPGFYKYPECLHCKCDTRGTLGGSNAC
DSTTGQCKCKPFVTGRKCDQCVDGTFALQDHNPFGCQR
Download sequence
Identical sequences T1G517
XP_009021396.1.102002 jgi|Helro1|83197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]