SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|84578 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|84578
Domain Number 1 Region: 299-570
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-60
Family Kelch motif 0.000079
Further Details:      
 
Domain Number 2 Region: 16-134
Classification Level Classification E-value
Superfamily POZ domain 1.41e-32
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|84578
Sequence length 596
Sequence
MTTTSAVTGAGQGRSYNSASHGCSVVEGFQRLWQDSSMCDTQLIVQGQTFHVHRCYLAAC
SQYFYSMFTKDFAEKMQAQVELKAVSALGLRALLEYSYTGSIVINDANLQDVLEAADHLQ
FNEVLTFCARHLRDELTVDNCLHFLRLAETYGLQECKRDTKAFILDNFVPVSKNEDFKQI
TAELLCELLADDRLRAPSEMDVFKVVCLWLEGPGMALSLYFQVLSLIRYGLMSAEQVESI
YSHPVLRGDACRDVLQAGLSYHMKLFSQPVTSAPHVCKMRAYKDCLVVMGAGYLDNTLCT
NMMAAPIKGGQLGPFVSLAPTKDRRYFAAVAVVNDFVYVVGGQTAMAGDGSHATNNAFRY
NPRDGKWLQISSMSVPRTHFSLIALPNCLVAVGGKHNRVALNTAEKYDFANNEWTPIPSL
QHTLFSHAGCAHGSKVYISGGCPGEDFTDDVWCFDLERPSWQQRSSLNQSRGYHVMVSHA
SKLYVCAGNTNAGDRHDVTMTECYDIEVDDWTILSSSAQGQSEAPAVKCDGKVFILGGYS
WDAHSFQENAQSYNIETDSWELLKNKLPEPMTGLPSIINLLFFSYYYLIIIILSIH
Download sequence
Identical sequences T1G5K5
jgi|Helro1|84578 XP_009023339.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]