SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|84585 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|84585
Domain Number 1 Region: 716-820
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-21
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 237-360
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 6-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.16e-16
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 140-278
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000581
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 553-692
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000235
Family Growth factor receptor domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|84585
Sequence length 904
Sequence
CDKNADCFNSSRSFTCKCREGFYGDGNYCLDVDECMVENGGCVHRCINSNGGYLCSCYNG
FKLDADDKNCVDINECEQDNGGCEQVCANTMGNFRCLCRDGYHLSEDGRSCRKGKNWCRE
DYNCPHICQPTKSGAIKCLCHPNYQMVKIGGKRECKATCKHHNGGCQHICHDTPLGTKCS
CHGRYQLQADAVSCVATCKVNNGGCDKICTNTEHGPHCSCPAGYTLKDNGRSCEDIDECK
TKNGGCSDGCINTQGSYECTCLKGYKIHTDRLTCVDIDECQFEDSCDHQCINTPGSFKCS
CRHGYEQYGGTHCADKNECSISNGGCEHTCVNTDGGFVCSCHDGYRLHTNMKDCVESVGC
SPLRFPAKVSVKCSTEENKEVIYLLISSSSSSSSSSSSSSSSLSSSSSLSSLSSVKFLDF
KCNTVKRKFRHLNNNNNNNNNNNSSNNNYNNNYDGRRNLVSAEFEIEVKSTAPTEDCGIE
CTRKRMVERKRSFVRLKRDMKPNVSIKYDGRPYKVIENSWRSSKPHDVCLPGQVLVKKKC
VMCSLATFHNNQTNRCEPCPPGTYQDEEGQTTCKRCNEFQNGVVGAKSALECGGYSCLPG
HYSENGLKPCRPCPLGTYQPDHARMMCIPCGNGILTARTAAVGFNECLVPERCKAGEYFS
RDENHCLRCSHDTYQPEEGQNFCISCPGDTQTDGEGATSSEECKERKCGGEIGLQQGFIQ
SPNWPGQYPSKVECTWKIAPEKGRRILVVIPEIYLYGGDKCQDFLVMRKSASPYSLTTYE
TCETSESPVAFTSRSRDLWIYFKTDESNNAAGFSIPYATYNEEYQDLVDDIVRDGKLYSS
FQHQAVIKDRKLLASLMEVIAQPYNYIKYANNNNNNNNTQHSQFPDSFIRFLRHKVYKFF
NKNK
Download sequence
Identical sequences T1G5K6
jgi|Helro1|84585 XP_009023340.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]