SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|85202 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|85202
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily vWA-like 5.15e-31
Family Integrin A (or I) domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|85202
Sequence length 114
Sequence
MKGCNNSVADIVFVVDGSGSIGYDNFDKVKIFLKKFIAALNIGPDPNLNSRISVVQFSGI
VQVEFKLNDYSTLEEYQAAIGNIVYLSQGTQTDKALDYLATQSFLPSSGARPAG
Download sequence
Identical sequences T1G5U3
jgi|Helro1|85202 XP_009024097.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]