SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|85424 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|85424
Domain Number 1 Region: 373-637
Classification Level Classification E-value
Superfamily YWTD domain 1.29e-43
Family YWTD domain 0.0000022
Further Details:      
 
Domain Number 2 Region: 119-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 3 Region: 194-239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 76-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 1-28
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000122
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 163-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000929
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 7 Region: 241-279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000113
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 8 Region: 317-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000161
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 9 Region: 31-73
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000103
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|85424
Sequence length 639
Sequence
CSDGNCIYAEWICDGTNDCDDGSDEQNCDNQVCPSDHRRCNATDSKSKCIPDMWWCDEMP
DCTNNEDEDPAECSQMVCEGDKFKCQTTNQCISMKWRCDVKVDCYDGSDELNCQEYTPCD
EFQCHNGACITMNWRCDGTDDCGDNSDEFNCTHHQRYRQRHHPQHHLTRNGTNCINSVQL
CDGVEDCGDGSDEDHQMCLTHACLEGYFRCHDNRTCIPDALRCDGSEDCKDGSDEASCVA
ASCKEDEFDCKRNGSECIKLYKLCNRYNDCLMGEDELTCDQSSSPTANPSILTNCSSASM
VINNKVVCTCPHGFKLATDNQTCVDENECLIPNICSHVCINKPSGKGYKCLCHPGYEMDP
KTHRCKAKGEEPVMLFANRHDIRRIKLRTGTYESVVDKLYSVIAIDYDYRDGFIYWSDVT
EETIYRLSLKSSAEVPKLLVHKDLSTPDGLALDWVHKNLYWTDTGQIEVMSVRDPANFHP
RRVLFGEMLDQPRAIVLDPRPGKYLFWSDWGLRPRIERSNLDGSSRRSLVTNNIRWPNGL
TIDYETERIFWIDAKLLSIYSADYEGGDVYLNFMCREYIKHPFAITVFEDDIYWSDWDTE
SINRNNNNNNNNNKVDMVVKRLLSPMGLLIFHGLRQPQG
Download sequence
Identical sequences T1G5W8
jgi|Helro1|85424 XP_009024292.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]