SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|86753 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|86753
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000428
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 2 Region: 228-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 3 Region: 113-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000929
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 292-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 372-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000875
Family EGF-type module 0.024
Further Details:      
 
Domain Number 6 Region: 74-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000875
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 7 Region: 188-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000789
Family EGF-type module 0.03
Further Details:      
 
Domain Number 8 Region: 152-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000149
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|86753
Domain Number - Region: 332-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000433
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|86753
Sequence length 409
Sequence
CKSDPCKNNGSCTNTGDDYECSCQAGYIGKTCSAIDYCVSNLCKNGASCRSLSGSFECKC
LRNFYGRLCEISDYCKDVKPCLNEGVCKKKGDLDFECFCRAGFSGKNCKIEEFCLSSPCK
HNGTCIQRREGYKCECNVPYIGWNCEVEDVCTHSNPCKNNAKCDVGADGKYYCQCTSVYE
GPNCEFNKQCMESKCENKGVCYEKEDGGYFCRCLGHYSGSNCEKLDGNADVCSSAPCLNG
GTCKVKESNSSSYDCTCKSGFFGNECHEKVNIYKMIKKYVMNCLYPLDPTTTDHCSSDPC
MNGGQCTLNIHSDYKCECSNAYTGVNCEFENKCADEQLCSGRGKCTYVFPASFKCHCNGG
YEGDRCEGVETACSKKPCKNDGTCQVDGALYKCLCKSPFTGSHCEKKGE
Download sequence
Identical sequences T1G6G5
jgi|Helro1|86753 XP_009026461.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]