SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|86803 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|86803
Domain Number 1 Region: 42-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000021
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 2 Region: 28-162
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 3 Region: 158-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000891
Family EGF-type module 0.006
Further Details:      
 
Domain Number 4 Region: 3-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000146
Family EGF-type module 0.038
Further Details:      
 
Domain Number 5 Region: 200-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|86803
Sequence length 226
Sequence
EVYQNVCESHVCHNGGICISQSHKPTCRCTSGWNGTQCTEKKDRCDPNPCKNKGTCIASD
DDYLCLCMLGYTGSLCETDLDDCAYEPCLNNGTCIDKIASYVCKCPPTHKGHLCQYRDDC
LTARNPCQGASTCMTSAIDGTLVCRCPKGYDGVNCDKDVDECSYGNICENGGTCRNLPGS
FQCQCPPQYYGKTCHNLKPYCISNPCQNGGTCENLLGDYVCHCADG
Download sequence
Identical sequences T1G6H0
jgi|Helro1|86803 XP_009026466.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]