SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|86982 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|86982
Domain Number 1 Region: 38-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 2 Region: 75-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000912
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|86982
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|86982
Sequence length 114
Sequence
ETGKTFCQNKVCMNNGYCGYDYLTYYCGCTGGFGSFDCRSTQNDCSSSRCRDGSTCVDKI
NGFECICAPTQSGEFCDKKFDPCLSNRCDSGSTCVSHGKSYDCICPPGKTGPFC
Download sequence
Identical sequences T1G6K2
jgi|Helro1|86982 XP_009026601.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]