SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|87238 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|87238
Domain Number 1 Region: 7-202
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.02e-52
Family Astacin 0.0000374
Further Details:      
 
Domain Number 2 Region: 328-438
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-33
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 3 Region: 484-591
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 4 Region: 199-328
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-20
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 5 Region: 440-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000248
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 635-740
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000196
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 7 Region: 592-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000998
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|87238
Sequence length 821
Sequence
REKRAAISRPHLLWDDGIIPFEFDTNFTGAPRSMIFGAMRAWENNTCVSFVEKTNDHKNY
ILFSQSPCGCCSFVGKKFGAQIISIGKHCDQHGIILHELGHVIGFFHEHTRPDRDSYVEI
LYDNILHDQKNNFYTARPGEVDSLNEPYDFQSIMHYARSTFSVRPFFDSIIPRSNTVNNH
DMGQRSYLSKGDISQTNKLYKCPQCGKTLMEPKGTFSTPQYTLTPLPDTHGHYRSSYCVW
RITGHPWEVITLTILSYDIPTTMKCYSNYLQVNDGAYYKSPLLGKVCGRNDSELVLTSTK
QKMWLEYRLLSGYMERQPGFYAKYHKTCGGHIKKDFGEFSSPQHPEKYSTSLKCSWIIEV
AENYSVGLTFKAFELERHQACACDFLEVYDGGDDKAPLLGKFCGVVTPASLQSTANKILV
KFVSDYSEVKTGFLAQFQKEKNECETSDHQCQQTCVNTIGSYRCQCSDGFELASDGRSCI
AKKDCEMELSNNTGTISSPSYPGQYPPNKNCSWLISVPKNHVISIVIDTLEIEGNDKECH
DSLKILSGEKDLGVFCGSSPPAPIISEDSAVQLIFSSDDSINKQGFLLSYSMEYNECSDM
NGGCEQVCIKTPGSYRCECRDGFTLNTNRRSCNGQCHREITNPSEVISFNNQSDSNTECT
WLLRADVGKRIQINYMDAEKKSNLTCSSNLPKTYDGPDETYPKLESNVTPPNNNKEQCPQ
LILSSSNILFMKFKPNTASEGNSSDQLALEAAVSTVCGGMVEADGSVRLFSFLPPSTENS
DDQPECEWLIQSKNKLKITLLINAIDSDGVSKCGLVRHSFV
Download sequence
Identical sequences T1G6N3
XP_009026841.1.102002 jgi|Helro1|87238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]