SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|87690 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|87690
Domain Number 1 Region: 308-421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-22
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 2 Region: 29-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-17
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 3 Region: 154-281
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000811
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|87690
Sequence length 427
Sequence
MYTFDNNDNKNNNNNDSYKNAKNKIGRCGRFFSPSFPQNYPPKSSCTYLFRGISDQVVGV
LFEEIKLETTVYSCLDSNDYILARDGSDVTDHVIQQICSRDEYDDDDDDRMMRIMMTSSK
RHLFVDFIVDDCHQGKGFKASYSFLASERQWFPNCDVNFTSVKFKSGFFTSPNYPIPYSD
VTAVMCRYLFAGVGLERVQLTFSQLDLSHPADDSKSHGCDGIDSLTVTSYVRGLPRDIGV
YCKRAKPPLIMSSDNRLEVNLVTYEGQKSHQGRGFRAKFAFVTDFGIKSGTKADDVACGY
AYHSTKSGSKGSITSPNYPGLYPRSTECHYFFYGRPNEYVKIHFNYFDLDGTFPKCIGDD
YVQFSNFNLRISDRKFMRYCGRLGGSMLLNDVISDGNFFRVTFSSNEVYDGFGFEAVYQF
IEAYSQY
Download sequence
Identical sequences T1G6U3
jgi|Helro1|87690 XP_009027758.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]