SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|87798 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|87798
Domain Number - Region: 3-74
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000746
Family Pentapeptide repeats 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|87798
Sequence length 112
Sequence
IQYNCIWYNCIQYNCIWYNCIRYNCVRYNCIQYNCTWYKCIQYNCVRYKCAQYNCTQYKC
IQYNSVRYKCCIQYNCVWHNCIQYKCIQYNCIQYKCIQYNSVRYKCVQYNCT
Download sequence
Identical sequences T1G6V4
jgi|Helro1|87798 XP_009027769.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]