SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|88449 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|88449
Domain Number 1 Region: 124-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000171
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 2 Region: 86-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000234
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 3 Region: 201-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000315
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 4 Region: 161-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000352
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 5 Region: 239-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000594
Family EGF-type module 0.023
Further Details:      
 
Domain Number 6 Region: 56-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000612
Family EGF-type module 0.043
Further Details:      
 
Domain Number 7 Region: 278-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000525
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|88449
Sequence length 322
Sequence
MLSLCSRRTGPIKCPTNVLCSVTSTDDGQNNNNSSNNINDNNKNSSSGNKAVTSSNTGKA
DSCLSWQDEIYCDCPPGFTGRRCEVDVDDCQNSPCLNGATCVDGPNSYTCMCNDGFSGLN
CSDDVNECSFKFCQHGGTCVNTIGSAVCSCSPGFTGLRCEHDVDDCQHANCSNGVCVDGV
NGYTCLCNHGYQGEHCDVMSTPCSSAPCVNGGTCVENFDEYTCLCPLSYAGCNCEFLQHY
CEPNPCQNNGSCTSLERGHHCKCIEHYAGTDCSERKMKCADVNCNNGRCVENKDGGVRCA
CEQGWVGAYCHVSDHIKLLNRI
Download sequence
Identical sequences T1G727
jgi|Helro1|88449 XP_009028218.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]