SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|89118 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|89118
Domain Number 1 Region: 600-807
Classification Level Classification E-value
Superfamily GFP-like 3.14e-37
Family Domain G2 of nidogen-1 0.00059
Further Details:      
 
Domain Number 2 Region: 84-172
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-20
Family I set domains 0.008
Further Details:      
 
Domain Number 3 Region: 158-252
Classification Level Classification E-value
Superfamily Immunoglobulin 6.46e-19
Family I set domains 0.0096
Further Details:      
 
Domain Number 4 Region: 252-308
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 9.94e-16
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 5 Region: 913-1043
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000141
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 307-365
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000196
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 7 Region: 479-536
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000641
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 8 Region: 424-475
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000128
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 9 Region: 1002-1133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000033
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 364-422
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 2-66
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000107
Family I set domains 0.04
Further Details:      
 
Domain Number 12 Region: 536-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000196
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 13 Region: 837-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000184
Family EGF-type module 0.007
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|89118
Domain Number - Region: 869-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000949
Family EGF-type module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|89118
Sequence length 1244
Sequence
IELACESSGIPTPKIKWKFNGVDIINQFAVEPNGELVIENSTKNDTGVYRCEAENEAGSD
FKNVHSNFIVESPRISTQTNLEPEVLNGHTTILLCQVEGHPPPKVQWLKNGYPVDVKNEN
YIFQDRNQHFEILQTTVEDSGDYSCIAKNEAGIDDLHFILNVLDPPKFKIPPTSITADQS
ATVTFDCVAEGEPEPEVHWLSEDLMKFGDRFSILSNNSLRIVAVQVEDEDVYECRIANKL
GTNVAYAVLTVQVHGQFSQWTDWSDCSASCGDGLQTRSRTCTNPAPRNGGRACAGSTAEE
RTCMPRPCPVDGMWSDWSAWTECSQSCGDGLKTRVRDCSNPHPKYEGRHCNGEGMERVLC
NAKPCPVHGGWGQWTEWDKCSEPCGEGQQQRHRECDSPVPKYSGDYCSGMIHDKRACKIA
DCEVNGNWGSWTEWSSCTLSCGGGMRKRERRCDNPPPSNDGKFCPGSDQQIDYCNKEECP
VHGKWAEWSAWGDCTLTCGGGQRRRFRTCTNPVPKHNGRACIGVAQETDVCNHQRCAVDG
EWSTWSMWTACSRTCDGGTQERRRVCRQPEYGGLACVGDPNQLKKCNTHPCEAKSLQSAR
ASVRGMLNSQAIDAKLVAEVDREPTHGVVTVGKITDLPTTLVQNFKPLLSILAPIYWSTA
LQVGKVANGFSLTRGEFQQISNVEFMNGELTIEQIAHGIDNEGMLTYDVTLTGSMLNMSE
ADGNISFVPFTEDYVQTGRNTLYAQSYRSYQLGDSRMPYKWNHTITYNLTLNKMPFLVQQ
LTIESAEVTYDPANNTLQFIVVSHVSKGEPSNQCPRGFILDPEEAFCADDNECTTLQMCS
HFCTNTIGSYVCTCPSGFKLDIDGRNCNDIDECEAGDDVCDGATDSECINTVGSFKCLPK
CLEGHRRSLASFECQDINECLEIPNLCSQLCTNLPGSFVCSCKTGYKLSSKSKCEDIDEC
TENLDNCVPGQVCRNRPGGFTCVNTCPTGFNLHANGSCIDVDECMSATGFCTPPQKCLNT
IGSYVCICPKGFKKSNNKLTCIDLNECSIPNICQHDCQNVPGSYRCLCPPGYRLTPDERN
CSDINECKEHSMACDPDKQCFNKLGGHECIELSCPPKYFFDPSSKFCMLNCDECSSPHTL
QFHLISLPLNFANGSGIIRLTVNNQDGLRLGLTSFNITSKDTASRHFNIRVENGVGVVYS
KQTLMEPREYKLKVESKSIDPMFPDVKFQTRFTLFIHVSKYTFS
Download sequence
Identical sequences T1G789
jgi|Helro1|89118 XP_009028556.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]