SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|89705 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|89705
Domain Number 1 Region: 19-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000376
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|89705
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00366
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|89705
Sequence length 98
Sequence
MECLCPFGYFGLNCNERATLCLVDECFNGGTCLTMSNETFCICPPGTSGSKCENLITSSS
HRHHKCHRDVCFYGGAYCQLDSIIFSFCFFDCTINNIR
Download sequence
Identical sequences T1G7G2
XP_009029609.1.102002 jgi|Helro1|89705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]