SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|90150 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|90150
Domain Number 1 Region: 177-324
Classification Level Classification E-value
Superfamily PHM/PNGase F 5.75e-38
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.0000546
Further Details:      
 
Domain Number 2 Region: 46-176
Classification Level Classification E-value
Superfamily PHM/PNGase F 1.83e-30
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.00018
Further Details:      
 
Domain Number 3 Region: 384-592
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.44e-21
Family SGL-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|90150
Sequence length 606
Sequence
MAIGLFFNYGCKNICFILTFTIFILLLIIASPLTSSSTPDDGSQPTSWVHTIQMPNVTTD
KEDKYLCIDYDFSIKSKHFLTGFEAKPDNPNVHHMLLFACSGKARSSKAFECLGGCFLER
IYFAWGRNAPPTNLPKGVGFKLATDGIDFLRYQVHYKTIVNTSDQSSLKLTFTTDPQPYT
AAVLLMLKNFLKIPAHTKLTIGNVSCRYNLQATMYPIAFRVHAHMLGRVISAYVKKSSGW
KLIGKGNPQWPQAFWPTNDKELVIENGDFIAAKCVYNSEHYDVDVNIGSTHNDEMCNFYL
MYYKNSSDSGEVNFCDKDEYTDISRDVPGFALEELPPNPDLEDVGEGHKHHHHHVQSNIS
TEAQLNISLKPASNWPMLTNGMELGEVTGLATDRFGFMYLFHRGSTKWMSNSFDENFIYT
GRDQPPIEDNTILKVNISSGEVVKMFGKNIFYMPHGIFVDHEGAIWLTDVAMHNVFKFPT
TLEDNPQASPSLILGEKFIPGLDNVHFCKPTDVVVAPTGEVYVSDGYCNSRVIAFDRFGN
FLKVWRVGEDENTYYLPHSISMDTQTGTIFVASRSSHSLYIYSVAGDFKKKITSDDFIPE
LFSVAY
Download sequence
Identical sequences T1G7L7
jgi|Helro1|90150 XP_009029896.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]