SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|90708 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|90708
Domain Number 1 Region: 30-170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.26e-22
Family SPRY domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|90708
Sequence length 348
Sequence
MSTAPTRRECGYRRTHDLIKKLDVSFDFELSSNCSLKNDGLVAVHQSSCAGYALVNLPMK
VGTFKWKIQLVRENVNNEGTCIGVCRLPIADCNYSSTSDMWLYRAYSGSLYHAGEVGYRQ
KFTQGDIITCYYDADNKTLAFAKNETTTTLAFEDMTSSEVYPCVVFYNPSRVEEVEIVDM
QMIVVSGLYHAGDPCLNPPASTMVEELIQLMRSLHSDLDVWTEVINDVLLDRMKMMKNMK
VVLERSLDSNFMKMPMLQNLLDALGRADEDNVDVNFPGDTKALAPNVYDVFMQCWPMLVL
LGGMDGGLRMGGRCRSKVTRKIGLVLGAAWVGSKTVKVVWDDADGSIK
Download sequence
Identical sequences T1G7U7
XP_009030977.1.102002 jgi|Helro1|90708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]