SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|91040 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|91040
Domain Number 1 Region: 814-1000
Classification Level Classification E-value
Superfamily Fibronectin type III 5.41e-34
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 2 Region: 1163-1270
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000128
Family Fibronectin type III 0.0064
Further Details:      
 
Domain Number 3 Region: 994-1109
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000446
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 4 Region: 597-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000642
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 5 Region: 460-504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 6 Region: 386-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.0041
Further Details:      
 
Domain Number 7 Region: 548-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 8 Region: 502-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 9 Region: 320-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000246
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 10 Region: 88-164
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000544
Family APC10-like 0.039
Further Details:      
 
Domain Number 11 Region: 763-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 12 Region: 709-755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.0066
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|91040
Domain Number - Region: 659-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 263-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000753
Family Laminin-type module 0.067
Further Details:      
 
Domain Number - Region: 3-30
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0198
Family Leech intramolecular trans-sialidase, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|91040
Sequence length 1308
Sequence
MNTGLNQFIGRIQDFRFYDDALSNREIVQIHTGLLPISRIQSNCFCPASHTFEQGSSDPI
GCYRNNIDLNYSNLTNVNNLDPIRVQRISPLSHPIEMLNDGNPNTYFLTNPIDSLTVEID
FGDVFEVFFTKITFFSPLPVWLKIEKVSTDLNNNNNNWVTWQYYSRDCMRDFGLIPNGPL
DNATSFNCLTIDGSQPSSLSGASLIFNLLTSSRPGYQSPGNQLDLINHMMASRVRLTMSG
HEESLTLRHQYFGIYEVEVIGRCDCNGQASECNTSSLPYRCKCNDGTYTTGDKCDRCLPL
YNNKPFKRGSANQRSSCRACQCYDHASSCYYNSSIDLFSTNQNLGGGGVCLDCQDNTAGT
GCDWCAKNYYRPDGRSLLAKNVCEECNCNPIGSEKSADDDGFDCEKVGGQCKCKRNVEGR
QCDTCKPGFFNLQGSNPQGCEPCLCYPGGASPVGASSPGVDTCHPITGQCLCKENVQGLK
CDVCKFGFYGLSTQFSAGCQPCNCHPQRSLKSTCDVTSGRCSCRDGFGGLTCESCADGSY
LLGSCRACDCDPRGSTPGTQCNKLTGACTCQPNVIGNACNTCMENTFNLSSSGCRPCTCD
LYGVIDLHNTCDVITGNCTCKEGVYGPKCDSCKPFYYNFRRAPEIGSISGYGSGGCQPCP
CDVSGTISCNDVTGACLCKQNRSGERCDRCITSSSSMTSPMTPPTCLPCNCNLAGTILNT
ACDPLTGQCQCKMAGSGVGGLACDTCLPMFWGFSTTSGECQPCKCEPAGSQDNECNVGTG
QCKCKRLTSGRRCDVCVDGASDLSASNPDGCVQVPGQMLPVSVMDSGPTYFTLSWLPPRE
ANGILIGYKLFRDGLMIYNGTNNDTVYNDTGLEPYTKYSYRISVENNVGTTSSPSLTFQT
GQSTPSGNFTFKVTNIKSRSARVTWSPPSKNNGVIRKYVVRISEMVYNNNNNNNNRLDLE
TNLTQLKPYTKVTIQVQCCTIIGCLSSQSEQTIVTLEEAPANQDAPSVTALNATALLVSW
SPPNNPNGIIIFYELWLRSPTTTNNNNNATTTTYSEPRMIFNPSGQYDPLIVPSGTSSLP
PPRTNFTAVNLAPFSNYEFKVVSENSFGRCESVWNGGYTKEDAPTFVSAPNVTMATKSQL
QLTWSDQSSKINGVVRSRAICHVVGYVIDISGSDSWKVGICANLSSTTYTYNLTNLPPYS
NISFYMALCNSVGCSNSQVTWSVTSLAAPDKLKSPVVIPLNSTSLKITWTPPAVLNGPQP
NYVIRRSQPAFSNTPVPVERGNTTVSFDGIGYYKFDANVVPQGVAYTG
Download sequence
Identical sequences T1G7Z0
XP_009031846.1.102002 jgi|Helro1|91040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]