SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|91226 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|91226
Domain Number 1 Region: 20-136
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-23
Family Synaptotagmin-like (S variant) 0.06
Further Details:      
 
Domain Number 2 Region: 146-262
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.4e-17
Family Synaptotagmin-like (S variant) 0.036
Further Details:      
 
Domain Number 3 Region: 296-476
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000278
Family Integrin A (or I) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|91226
Sequence length 545
Sequence
MSSRLANKLTAEPVTKVDIFVSCHNLLNMDTFSKSDPCCVLYIFIAGRWIEHGRTEQIKN
DLNPQFSKNFTVDYFFEEVQKIKFAVYDIDNTTPQLDDDDFLGQTECTLGELVSNSPLVY
PLMKNGMRAGNGTIIVSVEQGKQKDLLLMKFSGSSLDKKDFFGLSDPFLEFNKKMLDGGY
QVVHRTEYIKNTLDPVWKPFQISTSRLCNGNYRESVKVDCYDYNSNSSPDFIGSFETSVE
ELMSAATKPIQWPCVNPKKKAKKSSYKDSGTIHLLSCQISKQFSFLDFVFGGLHLKFCVA
IDFTASNGNPQSPQSLHYLHPQYPNHYVRAIRSVGEVIKDYDSDQLFPCFGFGARIPPHM
EVSHCFPLTFNEAHEHCYGIQGVLEAYYSSLPRLQLYGPTNFTPIIEHIGSLAAIAHNIR
QSYLYYVLLIITDGVISDMSNTVRAIVKNSTLPLSIIIVGVGQAEFDAMDRLDSDDGLLR
DQWGGVAQRDIVQFVPFRNFERASQEALAKQVLAELPDQVVSYYQANKIEPGKPRSDVDE
QKVLL
Download sequence
Identical sequences T1G811
XP_009031981.1.102002 jgi|Helro1|91226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]