SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|91316 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|91316
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.81e-21
Family Synaptotagmin-like (S variant) 0.05
Further Details:      
 
Domain Number 2 Region: 146-252
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.08e-19
Family Synaptotagmin-like (S variant) 0.0087
Further Details:      
 
Domain Number 3 Region: 293-470
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000344
Family Integrin A (or I) domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|91316
Sequence length 533
Sequence
MASMPNTQVEIAVSARNLLDMDITSKSDPLCVLFMKQLASTEYREIGRTEVIWNTLNPDF
VKKFVLDYFFEESQKLKFELYDVDSMSTDLSKHDFLGRMECTLAEIVSSNKLSKELTGIK
GKNCGTIILSAEELNASRDEIKLQFCAVKLDRKDFFGKSDPFLVISRVNEDQTYTVVHKT
EVIKQTLKPTWQPFVLPLRTLCNCDSYRALKIECFDWNRNGSHALIGQFSTSVNELSKGL
GPSNEYECINPTLQAKKGKRYKNSGIVKLIMCEIQQVPTFLDYIKSGVQVHCTIAVDLTA
SNGDPRSPSSLHYLDSHNPNLYARALRSVGEIIQDYSTDKLFPALGFGAKIPPDGRVSHE
IFLNGDSTNPYCIGVDGVLTAYYQTLSRVQLYGPTNFAPVINYVANVASKWRKEGKHYFI
LLILTDGIITDMPQTTEAIVRASSLPLSIIIVGIGNADFEAMNILDGDEVRLSYNGKMAD
RDIVQFVPFREFIGGCYGDDLGRSQAMLAKEVLAEIPDQFLSYMKRNVVKLKF
Download sequence
Identical sequences T1G825
jgi|Helro1|91316 XP_009032030.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]