SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|91560 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|91560
Domain Number 1 Region: 278-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000686
Family Galectin (animal S-lectin) 0.078
Further Details:      
 
Domain Number 2 Region: 399-457
Classification Level Classification E-value
Superfamily RING/U-box 0.000000514
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|91560
Domain Number - Region: 95-169
Classification Level Classification E-value
Superfamily ARM repeat 0.0269
Family Armadillo repeat 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|91560
Sequence length 477
Sequence
MFHFKSFILLPLSSHTTPNSLQLIQQFADNETSWMLVMEDLVYVIPPEQPLAPVAVSVIV
EECCVPSKELITKLSETLNVNDQGRVPPNVKMNRKMNICILLACLAEKMAGPLSVILLSE
MILSFLFRCIKDQSDPSLTLFALIALEKFTLTGENKCTILDRLKEDNILSGLECHHDNEL
DFRLRQIGFCVRWSLDNLCDNEQNNADAAATTTSPTAVATSPTTATVATSLATTPTAAIT
ATATSPTTATTAVATSPARTSIPTATAPTINVILNHDDGYGIGDDETSIAYDGCRQLIWY
KAKSTKHTQPCWKPGDILGLLLNVDSKEVIFSLNGDCLPPNKLLFTLDTPGGYYAAASFM
SYQQCIFNFGASPFVYPPKIAYKKLNDYGMLTLQQRTILPRHMKMSYLKHISISEDSCTI
CVDHQACIKLEPCAHTGFCEICAEVLENCPLCRQKIEDRVRSDVIKGDGDAVSRDHL
Download sequence
Identical sequences T1G854
XP_009010649.1.102002 jgi|Helro1|91560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]