SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|91727 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|91727
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily Cadherin-like 2.77e-32
Family Cadherin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|91727
Sequence length 154
Sequence
TTVYINLLDVNDNDPAFERDRYYTFVWEGVPIGTFVTQITATDADSGKNSRLLYDITSGN
PDGAFIIDPPSTGIVKTRRGIDRESRDVYRLVISARDSADIPRSASVILKVHVFDANDNA
PEFVGLDDVVVVKEGCSPIGSEVFTVRAADRDGG
Download sequence
Identical sequences T1G881
jgi|Helro1|91727 XP_009010768.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]