SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|92073 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|92073
Domain Number 1 Region: 20-229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-51
Family SPRY domain 0.000000434
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|92073
Domain Number - Region: 217-261
Classification Level Classification E-value
Superfamily SOCS box-like 0.0445
Family SOCS box-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|92073
Sequence length 276
Sequence
MKNKNLGYERTYFEITYEWPRRLDEILSHEPANQEKQLKHSWNPDDRSLNIFIKPEDPQI
IHRHPVAQSTDCIRGKVGHSQGLHYWEITWNQQQRGTHPIVGVATKDAPLHCPGYRNLIG
SNKYSWGWDIAKHTIIHNSIEKTLTFVNGIVERRRTNSPCDRVIPDTFGMILDMDEGTLG
FVIDKKYTGIAFGGLKGKTLYPVVNTVWGHCEVQMRYIASIASQPRSLLETSRKLIEKCV
LDKSYSENFSTLPIPKVLESFRGQNRPSHSSGGHPG
Download sequence
Identical sequences T1G8B9
jgi|Helro1|92073 XP_009012124.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]