SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|92382 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|92382
Domain Number 1 Region: 2-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000282
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|92382
Sequence length 61
Sequence
ADVDECLTDENNCTKNASTCNNTLGSFECLCRPGYQRISTFVCAQVTQPLPSSNGICSVY
R
Download sequence
Identical sequences T1G8F4
jgi|Helro1|92382 XP_009014447.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]