SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|93106 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|93106
Domain Number 1 Region: 4-42
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000456
Family Ovomucoid domain III-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|93106
Sequence length 60
Sequence
MTGECNRDCHCEGINFQPVCSQSQVQYFSPCHAGCSSKIHNPETNIYVCRFYFIFLTYYC
Download sequence
Identical sequences T1G8T7
jgi|Helro1|93106 XP_009024603.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]