SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|94513 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|94513
Domain Number 1 Region: 185-432
Classification Level Classification E-value
Superfamily vWA-like 1.01e-60
Family Trunk domain of Sec23/24 0.00013
Further Details:      
 
Domain Number 2 Region: 3-93,434-529
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.24e-59
Family beta-sandwich domain of Sec23/24 0.0015
Further Details:      
 
Domain Number 3 Region: 635-778
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.97e-33
Family C-terminal, gelsolin-like domain of Sec23/24 0.0013
Further Details:      
 
Domain Number 4 Region: 531-634
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 3.79e-32
Family Helical domain of Sec23/24 0.0026
Further Details:      
 
Domain Number 5 Region: 97-181
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 2.62e-21
Family Zn-finger domain of Sec23/24 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|94513
Sequence length 782
Sequence
MAQPARKLDPDQMPSQIQVLEDDKLKNNGVYVTGQRGSVPPLVTSNFIVDDQGLCSPRFL
RSTMYNIPCTSDLLKQSHLPFVVTLSPFAKQDPQENKPPIADLGQMGPLRCNRCKAYMCP
NMMFIDGGRKFQCCFCSCTTEVPPEYFAHLDHTGKRIDCFEKPELCLGAYEFVATADYCK
DNKLPQAPAFIFMIDVSFNSINSGLINLLCTRLKEDILAYLPKDEGDEESEVRVGFVTYS
NELHFYNIKNNLVQPQMLVVTDMNDVFVPLVDGFLVKVSEAEAIVDCLLAQIWSMFSNTC
EKESVLGPVIQAGLDALRSAERSGKLIIFHSSMPTAEAPGKLKHREDKNLLGSEKEKTLL
TPQTNFYTKLGQECVSAGCSVDIFLFPNMYVDVATISEVPRLTGGSLYKYNYFKADTDGE
MLMSDLRTNISRQFAFDVVLRLRTSQGIRAVDFFGNFFMSNTTDVELASLDRDKTISIEI
RHDDKLTEAEGAYVQAAVLYTSVGGRRRLRVLNSSFNCCTQVADLFRSCELDVIINFFAK
QAIRESLNTSVKQVREHLTNQCVQILASYRKNCATPSSSGQLILPECMKLLPVYINSLIK
SGILQTENINVDDRSYYIHLVNSMSISGTVAYFYPRLIPLLDIDVDDTSLPHAIRCSSER
LKDNGAYLLENGLVIFLWVGLSINAEWIQQVFGVPSVAQIDIDKTKLQDLDNPVSVRVRG
MVRMIREERNRYMKLVIVRQRDKLEPVMQMYMVEDRTPLINSSLTYVDFLCHIHKEIRNI
LL
Download sequence
Identical sequences T1G915
XP_009019733.1.102002 jgi|Helro1|94513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]