SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|95543 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|95543
Domain Number 1 Region: 141-300
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.47e-42
Family Pentapeptide repeats 0.00021
Further Details:      
 
Domain Number 2 Region: 9-111
Classification Level Classification E-value
Superfamily POZ domain 5.3e-26
Family Tetramerization domain of potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|95543
Sequence length 312
Sequence
MSSSLSSLNNWVTLNVGGKYFTTTRMTLVASNPDSMLARMFDGDSSWSHTTDNNGAILID
RSPHYFEPILNYLRTGELFINSGIDYKGVLSEARFFGVVGVVDILTKRLENENLEEKFTE
QPFTRREFLKMIIGTPSSWELRCQGINLEGCDLSKLDLRHINFKYANLKKADLSMTNLSN
CNFERADMTGVKMDQATVLAVRMLCVNLESASMKGCNFEDPAGSHTSMEGANMKGVNLEG
SRMAGINLRVANLKNANLQNCDLRGAVLAGTDLENCNLSGCDLQEANLRGANLKGATFEL
MLNPLHMSQAVR
Download sequence
Identical sequences T1G967
jgi|Helro1|95543 XP_009025272.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]