SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|96652 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|96652
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily vWA-like 0.000000119
Family Ku70 subunit N-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|96652
Sequence length 1013
Sequence
MTIIVFLVDTSCSMNQRTYAGTTFLDTAKNAVEMFMKIRSRDPNCRWDRYMLLTFEEPPM
NVKAGWKESHATFMKELKNLEAHCLTTLGPALKHTFDMLNTNRMQSGIDTYGQGRCPFFL
EPAVIICLTDGKKMTSLTGASNELNLPMNVACLPGSELTKEPFRWDQRLYGIVFKMSATP
IQDNLTYIPSDDSSIDAMCEVTGGRSYAVATQKMLMQCLESLVQKCQSGVVVNFEKLPSE
PHSNNNNNNNNNDSNNNNGGSGKSQNSPQNQPWHNCKRLIYVPRSAQRGGTVGHWPIPEA
YWPDASRDVLPPRTAHPIINFSCQPCEPITLENLPFDKYEMEPSPLTQYILERRQPHVVW
QVYMQNSCNKYSTSDIGYPFGYIKASTTLNAVNLFVMPYNYAVLVPLLDELIKVLKYKPT
IKWKMQFDAYLKTVPAYYANPLKRAFSRMSLPPTLNLIPDQMDNCLSYSVVLHLKKIKNQ
AKLEYDRLVASVGQYPTHCPTIRVLPSRPPTPRLASSLSSSTSSSAQRGDFKHLIIQYSA
GNACGPKQGLLSSHNNMNNNNNNNMNNNNLGVDSFEVFNLHAIQKIVDTHIYTNPYDIHR
SDLLLNLAKMRMNLLKSHNHALSTKFQNMDAIHNSPIQEMGNYQDYLKRQQPPLREIETT
PTRVHTFGNPFKVKNMMIDEADEAMPGQSSSSSSSSSARKRSLSESSTSSSTSSSSSLSK
ANKKRGPIPRSYTLRTFLSSLSSSPPPPPSSPSLPSSLTPCPPTPIPSSDPVKSGSDDAN
RSNDVTMTSDENEPCIDLKVGSSEQTSLAGQSSDHSKLRKKNKNKNINNNKNKNNSNNNN
NSMTTNNKNDLSIINNNVENIKMTNGIDVLVSQNHINNNSSNIADDISLDNSSNDAINNG
VTDDDDFEVASSVLELLNSKKSILNGNVDTASFNSEIKKLIVTEVKKPGKKYTIIFNLLR
CLRGDTSEKRSQIEKVISEASRFKKYALVRILEEYCNNNNRNNYSNSIRNNFL
Download sequence
Identical sequences T1G9D0
XP_009031579.1.102002 jgi|Helro1|96652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]