SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|96746 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|96746
Domain Number 1 Region: 264-547
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-82
Family Kelch motif 0.00000129
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily POZ domain 7.06e-28
Family BTB/POZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|96746
Sequence length 552
Sequence
MMQRMEMYLHRRQLCDVVLITTSGRRVPAHRLVLAAASDYFAAMFTSDLLEADLEEVVIK
EVEPDALVACVRYIYTGQLDLREDTVESILSASCLLQLPEASIVCSRFLSKQLHPSNCIG
IRQFADLQGCCRLYDEANAYVLENFMEVTKHQEFNFLAADDLVQLLCSDDIRVSSEVVVF
EALVCWAKHDEVERKKDLGRLLACVRLPLLPAQYIADKVAACPLFREDLFIQDLIMESLK
YHLLPERRMTMYNMRTRPRKSTVGVLYAVGGMDCGKGAVSMEKYDMRTDQWSQVACMNGR
RLQFGVAVIDLVLYVVGGRDGLKTLNSVECYDCRTDTWSSVNPMATHRHGLGVGVLGGPM
YAVGGHDGWSYLATVERWDVQTQQWSYVAPLSTPRSTAGVVVLGNKLYAVGGRDGSSCLR
SMECYDPHTNKWSICCPMNKRRGGVGVAVCNEFLYAVGGHDAPSSNPASSRFDCVERYDP
KTDTWTAVAPISSPRDAVGVCVLGDKLFAVGGYDGQRYLNDVEAFDTHLNEWSEVAPLRV
GRAGACVVHLAL
Download sequence
Identical sequences T1G9D5
XP_009010059.1.102002 jgi|Helro1|96746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]