SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|97665 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|97665
Domain Number 1 Region: 66-161,208-456
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.22e-25
Family LacY-like proton/sugar symporter 0.056
Further Details:      
 
Domain Number 2 Region: 484-539
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000305
Family Ovomucoid domain III-like 0.0099
Further Details:      
 
Domain Number 3 Region: 573-681
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000288
Family Glycerol-3-phosphate transporter 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|97665
Sequence length 700
Sequence
MLPTNKEPEKLSIVDSLQGHIGNVERFLETSSSAERASNLNFPSQIIVTSFPTTIRLKYG
CFHKFFMKIGTFLCVACCFVALQGMVVSGFVSVCLSTLERRFKFSSTESGIIAMGYDLAS
IICLVPVSFYGGLGHKPRWIAVGALVMGVGSLVFSSPNLLVGPYFYDTRKDPSMLCLDSA
PVNRSGTMEKYECSYQATTSSSIYIVIFMLGHMLHGAGSTPLFTLAVAFIDENVGVKRSP
LYFSIYYSTAMIGPALGYIIGGRLLKTYIDIGRKNSTLNQGDLTPEDPRWLGAWWIGFLV
TGSAFIILSIFLCGFPREMPSRFGNIKFILKIQRKRSSLESVDKKSVDAVHEPADIFHAL
KTLLSNPAFDFITFSGCMEGALVGGFVLFAPKFVEAAFNLSASWSGQLIGIATIPSGSLG
IVIGGIIVKKFHLSAIGSLKFTLVFLGIALLLTLSMLVRCGDILYVGISHPYLDQEVTNS
KINLFSGCNKHCNCSGSMFSPVCGLDGLTYVSPCLAGCQSMKEIKEKNGTWRLFIKCTCV
EDRLEHNNIKTKKPYTLTDDVTASDGTCKNKCNSITFFIIFYSLIIFVSFICWTPVLTAT
LRCVAERHKSLALGLQWMIVRIVGMIPAPMIFGAIIDRACLFWNRDYCFDRTGSCAIYTG
EMMGIYFLSIVITLKTLSFFFILIAAICLKKSKFNSNRNK
Download sequence
Identical sequences T1G9I5
jgi|Helro1|97665 XP_009012688.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]