SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|97933 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|97933
Domain Number 1 Region: 18-255
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000000049
Family Serum paraoxonase/arylesterase 1, PON1 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|97933
Sequence length 323
Sequence
MYVRRLKSFSITNAEFGSEDIKVLLNGKAFVSSGLQLFGEGKKNSVGRIFLFDFKKPHEK
VLKLEVLDENSREIPLTPHGMDIWVDKKSGITYLYVVNHYAGMESVEKFQFLPELKLVRV
KQFRDKNFILLNGLYMINEDQFYFTNSYYFNNAVEFLLGLKWGSVGFFDGAKAELVLKGL
NFPNGIIKWKNFLAVGMITSEKLNLYSIGNDHFLTLNKSIDVGSGLDNLSLDPNNGDLIL
GCHPSIYRVVKHSADPDAFKAPSQILRLKYKEDETTELSEIYSNDGSEVSGSSVGVLYED
GMLIGTIYTDMLYCKLDRNKKSF
Download sequence
Identical sequences T1G9J6
jgi|Helro1|97933 XP_009013170.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]