SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|98272 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|98272
Domain Number 1 Region: 75-377
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.13e-34
Family beta-glycanases 0.027
Further Details:      
 
Domain Number 2 Region: 612-717
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000232
Family Laminin G-like module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|98272
Sequence length 718
Sequence
MGNLQKRAVRESNVITSTSIAVAVIFYLQRSILPWLLLITAMPRAASPQVAGSSDASTCN
GTYYFDYSDGFGRTFDGVGAISGGGATSKLLSDYPEPYKSDILDFLFKPKFGAGFQIFKV
EIGGDAQSSEGTESSHMHEEFDENYQRGYEWQLMVEAKKRNPKIRFCGLSWGYPGWLSGG
QWTPYYDVTKTGMYLVKWVLGAKKYYDIDIYCLGIWNEKPYNKELIKTLRRLLDKHNMTS
VKLVAGDQLPGGAWTIVDDVTKDPELFQAVDIIGTHYMGSQSTKQSLTLNKPLWSSEDWS
SDHYQEGGGCMARLLNRNYLIGQYTSLIAWNMLCGFYPGMSYDGKGMMMANEPWSGHYEV
GVPIWAMAHTTQFTEIGWRYLNVERGVGWLNFGGSYVTLVSPSLDEFTIVIETMDTSENK
FCNRPPAFPMKVLQQTANLALKGDLARNRTYLHLWRSILTEDNNDSLLFNYLGKITVNEG
RIDPLNLSVNSIYTLTTLSTGFKGKPRYVSPQSGKFPSVYKDDFESYREYQEAVAFSQQV
GVFEIRSTNYRRHNKVMRQVILNAPVHWCPFVQTTPMGVIGDSDWTDTEVSVDVMFPFVN
SSHGAYVAVRVDHGGCTTFLTTGVFFYLSIKEQRLNLYLDISRTLLVESISVKLEANQWY
RATLIVQGKSYEAYIDGTLVMEGHFQKGDENIPTKGYVSIGTQNFGFTDFDNLSIFNF
Download sequence
Identical sequences T1G9L6
XP_009013948.1.102002 jgi|Helro1|98272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]