SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|108545 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|108545
Domain Number 1 Region: 282-371
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 9.02e-33
Family Small-conductance potassium channel 0.0000317
Further Details:      
 
Domain Number 2 Region: 153-324
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-25
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|108545
Sequence length 489
Sequence
MTNKKCGFRLGKRKLLTDKRRFVSNCCLVCALFGIVAMIVETEMTMANVYDKSSKYSCVM
KSLVTISTAILLHLILIYYRLQAQLFIVNNSLGDWRVALSWPVILQATLEIVVCSIHPFP
GDIKFIWKSVSVDDDDDSHAVSIDLLLTFPMFLRFYLVGRVMLLHSRILTDASAVSIGAL
NRISFNVRFVLKTLMNICPGTVLVVFMLTVWILASWTLRVCECYHDPKHKNFLNSLWMIA
ITFLSVGYGDIVPRTYCGRSVAVFTGVMGSGCTALVVAVFARKMELTRAERHVHNFMIDN
QLSKKLKHAAANVLRETWFIYKYTILADKLDARKIRRHQAKFLTAIHTLRDIRSKLRTLN
DNANTMMDVSRHLTHSALNTTPTVYSSQPPAIYQQMQVQLSQAISDLYSRQLSTEQKTTS
IEDNLNWLQNQLESLPEQVLFHMSAPCDSPSPLLGNLADVSMTSHLRHLHHQNVNDVTTT
LTEPFEAQL
Download sequence
Identical sequences T1EEK2
jgi|Helro1|108545 XP_009030617.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]