SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|119254 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|119254
Domain Number 1 Region: 285-376
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.57e-37
Family Small-conductance potassium channel 0.00000969
Further Details:      
 
Domain Number 2 Region: 156-326
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-27
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|119254
Sequence length 408
Sequence
GSLSKNNVGYRLGKRKMIFERRKRVSDYALVFGILGTGIMVIETEMCMAKVYNKESFYSS
AVKSLITISTFVLLTLIVAYHALEVQLFAVDNCIEDWRIAMTCRRIVQLSLELVVCSVHP
FPGAWYFRWTTVHADGDHVTTRQVPVDLIFSLPMFLRLYLICRVMLLHSKLFTDASSRSI
GALNRISFNTRFVLKTLMTICPGTVLLVFMLSLWMIASWTLRACESHHSEKHKNLLNSMW
MIAITFLSVGYGDIVPNTYCGRGIAVCTGVMGSGCTALVVAVLARKLELTRAEKHVHNFM
MDNQLSKRLKNAAANVLRETWLIYKHTTLAKKVKCERVRTHQRKFLQAIHSLRQVKMEQR
KLNDSTNSLIDMAKTQSNILETVVEMSARQLLLENKADRFEPQLLQLQ
Download sequence
Identical sequences T1EGM8
XP_009011661.1.102002 jgi|Helro1|119254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]