SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|157983 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|157983
Domain Number 1 Region: 489-665
Classification Level Classification E-value
Superfamily Sec7 domain 1.31e-49
Family Sec7 domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 287-459,927-1379
Classification Level Classification E-value
Superfamily ARM repeat 8.93e-22
Family Exportin HEAT-like repeat 0.047
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|157983
Domain Number - Region: 65-209,236-384
Classification Level Classification E-value
Superfamily ARM repeat 0.000357
Family Armadillo repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|157983
Sequence length 1575
Sequence
MREQKPAQEMFITRALEKILSDREIKKSHHFQLKKACEAALDDIKNDNQLNKLDTHTMGS
VETDKYFLPFELACNSKSAKMINTSLDCLQKLIAYGHLTGNSPDPTVPNKRLIDRIVEVI
CNCFTGPQTDEGVQLQIIKALLTIVTANTCEIHEGTILLAVRTCYNIYLASKNLVNQTTA
KATLTQMLNVIFSRMENPAEDTEISKASSPLPTATSSTVQSPPSTTTTQNNATTTTSATQ
ISSNSSELFSHILQKDAFLVFRSLCKLSMKPLADGPPEPKSHELRSKILSLQLLLSILQN
SGPVFQSNEMFINAIKQYLCVALSKNGVSPVQGVFELSLAIFLSLLSKFKQHLKMQIEVF
FKEIFLYILESPTSSFEHKWMVVQALVKICADAQCVVDIYVNYDCDLSSANIFERLIHDL
SKIAQGRQAIELGATANQEKSMRVKGLECLVSILKCMVEWSRDIYTNPDSQSTLENYLKY
GNSRKNYGRMELISYFNKRPRKGIMYLQEQGLLGTSAHDIAEFFHNDERLDKAGSTKRSC
TPILTILTSQTWTLYLLSGNFSKASFRLPGEAQKIDRLMEKFASRYCECNPSLGIFSSAD
TAYVLAYSIIMLTTDLHSSQVRHKMTKAQYIRMNRGINDSRDLPEEYLSAIYDEIADNQI
KMKPTAPPTQKTPASGMTERQRRLLYNMEMEHMAYAAKALMESVSHVQSNFTSATHLEHV
RPMFKIAWTPLLAAFSVGLQDCDDQTIANVCLDGIRCAIRISCVFHMELERDAYVQALSR
FTLLSATSPITEIKSKNIDTIKTLISVAHTDGNYLGKSWHEVLKCISQLELAQLIGSFVK
TRYITSSSSLTFGGGGGSGAAGSGSGSGGGGYGSHHPNSEVFDPEGGAGNSRRDVRAMQE
SMEETSSQSVVVAVDRIFTGSIKLDGDAIVEFVKALCSVSVEELSSVSHPRMFSLQKIVE
ISYYNMGRIRLQWSRIWQYIGEHFNNVGCNPNEDVVFFAIDSLRQLSMKFIEKGEFANFR
FQKDFLRPFEFIMKKNRSANIRDMVVRCVAQMVNSQAPNIKSGWKNIFSVFHLAASDHDE
ATVDLAFQTTGKIINSIFEKHFSAVIDSFQDAVKCLSEFACNSMFPDTSMEAIRLMRHCA
KYVVEKSQEQLMNVSEEDRLWARGWFPVLFELSCVISRCKLDVRTRGLTVMFEILKSYGD
TFLSKWWNDAFKVIFRIFDNMKLPESQHEKAEWMTTTCNHALYAIVDVFSQYYEVLSGVL
SKQLYEQLLWCVQQDNEQLARSGTNCLENFVISNGERFTENAWEEACACMSLIFQNTIPN
ELLTWRPENHKDDDGDEKYDTINVTSAYRALDQVTRREGSISDHDLFNSLLIKCVVQLEL
IQTIDNILFYPTTSKKEDAENQASAKVTLGMFHYLSPDQLFVLLDCLLKSHRFARTFNSD
QEQRSLLWKAGFKGKMKPNLMKQETQSLACAFRILFHLYTQPTNHSQALNFRKKTGTDAL
QYFLSLQSDRDREAWSNLLLLFLTRIMKLETSKFRKHASIYYPYLCDFICLELKPEIKNT
LKKFLLRCARDYHIM
Download sequence
Identical sequences T1EMI5
XP_009029723.1.102002 jgi|Helro1|157983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]