SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161732 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161732
Domain Number 1 Region: 219-349
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-23
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 2 Region: 367-491
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000183
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 24-85,149-202
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000605
Family Spermadhesin, CUB domain 0.0055
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|161732
Domain Number - Region: 500-533
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161732
Sequence length 616
Sequence
MQKALSHRTSSPLSSPQPSPSLPECDRIIRSNSQSSGIIKSPYYPEPSPRDILCHYDING
LVDRQNLEKVQLFIEDIDIGEDYVEEYVDTVVARGVAVGGAAASAAAGRNVARFNRSKCQ
NGALQAYTTRASQKSLAMYKIELQEQSTTKVSLPIPDYEFCGTSGNGRFGSYSITSDSPK
MLLIYDTFGARSRRGFKVRYQFSTDYAIPGTAISGESPCHFQYMSTSAIQGTFNSPRHPS
NYPDNTYCVYEFHGQPDEIVRLTFENFQVEDDANCSKDFVKIFKWLPPKLEEEGQQQQQV
ENLEFVPVGHYCGERFPGPQDEDSQIMRVTLNSDGHTVYKGFRARYEFVKRQPPDKKCFH
SITNIGGGVINSPNYPHKYTTNKTCEWIVYGRSKANKILLTFDIFSIEGNPNEKKSFKSN
QTKLSVEIGCGNAVLKIYSTSRSNMPAYELCGDNDTIDNLQIITKSNVLRLKFVSTAKAT
GGKGFRLPWTEILPMKGGRCPGFLCEKSGHCIPNDMKCNGVANCGKNDRSDELKNCETST
LNVVLCVLGVCFLLLILGGLLWLYCKRKKKKPEKDQKIPEVRIVTGVSEKRPRSANRKKR
RKKRRMKEKTEMITIM
Download sequence
Identical sequences T1ERU6
XP_009019869.1.102002 jgi|Helro1|161732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]