SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161733 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161733
Domain Number 1 Region: 177-284
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-23
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 2 Region: 48-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-18
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161733
Sequence length 298
Sequence
MNILIINSKCCLLVFILCRICHLKENCTTIKRSGPNHKTGILKSQANESYQNNIRCYYYF
EALPDERVELNFTVFDVNGVPPRCLHDFIDIYTQLDSLNVSLLDVPSQGRYCGKDKENLP
YLIISVKNIALVDFHTDSSGDGKGFELIYRFFSDAIYKVGTKLQQYLCGFLISDLKEGTI
LSPTYPGIYPDNIMCFYKFQGEVGERIKLTFNDIDLYSGGNYCPFDHIKIYDGPNNEAHV
IDTICGSRKVPIAFYSNGNYLQIFTVGESDETPSQLRGFNASFEIGTRFVDLSLVTLL
Download sequence
Identical sequences T1ERU7
jgi|Helro1|161733 XP_009019870.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]