SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163186 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163186
Domain Number 1 Region: 8-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000324
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|163186
Domain Number - Region: 374-490
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00366
Family beta-sandwich domain of Sec23/24 0.023
Further Details:      
 
Domain Number - Region: 111-131
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0262
Family beta-sandwich domain of Sec23/24 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163186
Sequence length 556
Sequence
MAELQRHQKRCTEKENPGCLNGGLCFWYIALEYAMCKCLGEYSGEKCEHGSPPKHVVSPD
PPTYSPDKSTLIIIVILLLIFCALALVAYFVAKLRKDYKAMSRMQDHLISPPLQQPQQPQ
QPQQPQQPQQLESYNSGGTVSNETKSEATTLTPRMVANTRQQHSKNANQNTASNASSISR
AKNREKSSRSGNVAAVAAAYTATTTSTSSKTSAPSSTARVGTGNNGSNKSVRRNKAGKDE
YVISNVYTKKSCNGNNCNYGGDDDDDDEGGNDDGFDDGYANELRNNTRVDMFNNYINNKN
NNNINNMNTMNNNNSYNTNNVSKKDSTTKTQKFSKTKLMLALADANTTTAATILATGATT
TTRTITSNFRLMVQQKQQKQASFQMSQHQHQPPQQQQQQTQQQQQFYQPTMQQKLPQQQQ
QQQPQLVSATSSNDKRPRLAATSTTPTNGYKFSLNPTIPTTTNNNNSSNNNSSSNNCSSS
NNNNNINKKLEKFENLLKMSCNIPIRKTYDVTQKGRNIKSIADNINNDINNCNINNNNIC
NISSFATKFTTFFPYV
Download sequence
Identical sequences T1ETS1
jgi|Helro1|163186 XP_009025383.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]