SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|165050 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|165050
Domain Number 1 Region: 64-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000401
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|165050
Sequence length 204
Sequence
MSAQKKFWLKLRPKQDYLVLAEAGPSTTALRCKYNNLQICVANSTIYSTAFYVNIITIPK
LRLVCSDVCQRTAHNQYKCTCRHGRVLSPDGKTCSTDVHVPAIYLASNTFLTRLIIDNIG
SDSFEKINNIRFNGLTSLSFDPITYSIYFSDTSLNENLPNVDDMFGQHNSIVNPEHENNE
LINNNRDDNMDDVIGLVHLETLVM
Download sequence
Identical sequences T1EW73
XP_009029197.1.102002 jgi|Helro1|165050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]