SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|166292 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|166292
Domain Number - Region: 141-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00703
Family Spermadhesin, CUB domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|166292
Sequence length 267
Sequence
MTRALYGRMARGTCVHTDFGYVGCFKDVLFLMERRQCIVGVPDREMSSLKPCNQDLKLYL
EAGYRCMKVHQATKKCDSQTSLNKLSHYQQQQQQQQQQHHYNKQLNNDNDNNYINSNNND
DSNKMKNNKISLLPNEIQVTNTAGYLPSILTAESGCGSHEHPWIIRALPGQKVRLKLIDF
SMKGTENGGEGGGGSDQKMYLTNCSVCAIVRDALMQTGTSLCRNYSRNSHVYTSLSHVIK
LRIIIGRENDVTPQFVFIYEGRQEECF
Download sequence
Identical sequences T1EXZ6
jgi|Helro1|166292 XP_009031501.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]