SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|166479 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|166479
Domain Number 1 Region: 15-153
Classification Level Classification E-value
Superfamily vWA-like 5.72e-26
Family Integrin A (or I) domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|166479
Sequence length 167
Sequence
MVAPIAPRSSSSSAPKPCLKRRVCTVQIDLVFIFDISGSVIDEYRKSVSFARHITSGLDI
DSDLVRVASVAFSVNVLSYFLLSRFRGDKEASLKAFDFTNAGGQTNIRSAMEFTASTLFV
QSNGDRPGVPNVVILITDGYANVNELEPGQGADLLKRHKSIQQFNTK
Download sequence
Identical sequences T1EY63
jgi|Helro1|166479 XP_009009973.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]