SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|168898 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|168898
Domain Number 1 Region: 604-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000722
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 794-919
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000133
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 380-494
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000132
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 54-171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 478-608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000957
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 229-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000196
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 7 Region: 720-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000214
Family EGF-type module 0.0022
Further Details:      
 
Domain Number 8 Region: 915-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000304
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 9 Region: 761-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000982
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 10 Region: 267-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000274
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 11 Region: 334-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000368
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 167-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000191
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|168898
Domain Number - Region: 306-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00172
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 206-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0731
Family EGF-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|168898
Sequence length 959
Sequence
MQIILKTSTSVMLELHACTVVPATTYLVATTACVPLNIPEPTAKQRELFATDVDECLKTP
CVHDSSCQNRDGGYDCVCPSGFIGKNCETDIDECLANPCVHSDLCSNTEGSYICNCTSGY
TGKNCNIDIDECADTSLCKNGAKCFNIDGSFFCQCEVGFEGTLCSEDVNECELSTICLHN
GLCHNTYGSYYCECDGRFKGSNCQTDVDECAATPDLCKNEAPCHNTEGNVNECDDTPCLH
AGLCNNTFGSYSCDCTAFYTGNNCQTDVDECTTSRPCVHATSCQNIDGGYICHCSQGFEG
IDCDKDVDECKDMTFCKNGGSCTNIDGGFICHYVDECQIGDPCNGRGSCLNKYGGYLCNC
ESGFTGKNCESDINECLTGSPCFEGGTCENTIGSYRCKCASGFSGENCKSDVNECDTIAG
LCKNGASCANTVGSFSCQCNVGFQGDTCASDVDECMLSAPCLHAVFCENTNGSYVCHCTT
GFTGFNCEIDMDECVDDDLCKNGANCTNTYGSFTCQCAAGFEGPTYIDECVIAPPCNGRG
SCQNTDGGYICHCNSAYEGKNCEIDVNECADISLCKNGALCINTVGSYNCQCSPGFKGPN
CATDIDECISFPCNNGGLCQNTNGSYVCHCTAGFTGDNCNSDINECADNPCQHGGTCSNS
FGSFSCSCTSSFTGPTCASDVNECLLGNNPCLHGGTCQNSFGSFECQCPSGYTGAKCESD
IDECLVGNACQHGGTCVNSFGSYTCTCTKGFTGPTCATDENECNQGTPCLHGGTCYNTFG
SFTCQCSAGYTGTVCDSDVDECMVSTPCQHGGTCQNSFGNYSCQCTAGYTGPVCQTDVNE
CVQGTPCQHNGTCQNTVGNYTCQCPSTYTGPNCQIDVNECQTDSPCKNGATCLNNDGGYT
CTCTAGFTGLTCQTDINECRAGTPCKNGATCVNTVGSYACQCRSGFSGPTCQSESNNNG
Download sequence
Identical sequences T1F140
jgi|Helro1|168898 XP_009012994.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]