SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|174105 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|174105
Domain Number - Region: 39-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00114
Family EGF-type module 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|174105
Sequence length 151
Sequence
MINVKFILALLFIGSACSSPYIPPKKTFMDQYVEVFLKHQCNDATAYACSKHGKGFCVVD
DICLCSPGYTGKNCDEQRGVDPNFESCKRDEERSPFIRDWMEFNRIHTINVTWPSRTGVC
KHFAVRAALRTILPLKGRPVVCPPLPYGICA
Download sequence
Identical sequences T1F7M0
jgi|Helro1|174105 XP_009018899.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]