SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|176332 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|176332
Domain Number 1 Region: 128-298
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000000216
Family Serum paraoxonase/arylesterase 1, PON1 0.089
Further Details:      
 
Domain Number 2 Region: 23-166
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000256
Family WD40-repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|176332
Sequence length 305
Sequence
MAIMAKLIFSIVTLVILSVFVTAEKPQLLATFSNGTPVYGLAVLKNNLIAVSRENSGKLQ
LYNVAINGLFTELNSVDMARSDSYYDMAYLNKSEQFVLLNWLDSNKIILMQSRFPYEVKS
WNFTSDTTMASLAVTESDQTIIVTEGMSKQVKIYDPSGKLLRTIKLQMARSPRQAIRLSN
NLYAVTAGYETTESHLVCRFNVKGYVVGRCFGGRPGNSINQLNVPARMVLLNDGSVLLAD
MKNSRILKLNKDLSSAEIFLGASDGIHQPYRLYADESKRILYVADNTLDPVTSYAVSGRV
IAFRY
Download sequence
Identical sequences T1FAE4
jgi|Helro1|176332 XP_009021801.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]