SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|177689 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|177689
Domain Number - Region: 279-327
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0204
Family Duffy binding domain 0.025
Further Details:      
 
Domain Number - Region: 182-215,303-337
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0306
Family Spermadhesin, CUB domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|177689
Sequence length 389
Sequence
MTQIYLLNAVVSVFRKPQPTTSDHNQPPAELIQLDVCMFEHFNISCPPPSTSLTSSSSSS
QSTPFTPPLLSSSSSSSSSSSSSSSSWVMKDQVIIMSRARLGRMRESKSTCDFPFPDTDF
FSVKPCPKDLASYLEVAYYCWTLPPPHPATLASTSSHHWTQQQTPTGYKSLKHVTTESKQ
TPPSCFWMIEALEGQTINVTAFNFASTQRSYYSHVQQQQSLQHHHQPQHFYNNIDSAIST
NVYVDKTCSPTVATITDIIKMNFTASGSSSGSSGGSYNNNNNNNNNNNNNNNNDNNNNNN
SGSDGSSGGSHNIRVCSDDRREKLVHSSKSHALKLQFHGGGEEMLLRYRDKKELNGSLLI
IYGLPLAMVETTRLKNISNKIFLHKPMAK
Download sequence
Identical sequences T1FC31
jgi|Helro1|177689 XP_009024079.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]