SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|180041 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|180041
Domain Number 1 Region: 450-733
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.54e-68
Family Complement components 0.0000289
Further Details:      
 
Domain Number 2 Region: 807-926
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 9.03e-24
Family Alpha-macroglobulin receptor domain 0.00057
Further Details:      
 
Domain Number 3 Region: 294-346
Classification Level Classification E-value
Superfamily E set domains 0.000000672
Family SVA-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|180041
Sequence length 970
Sequence
MAKGQLIRSETKKFKKPLNTQTFSIDITKDLAVQLAPEARFSISIVTENGELIYDSLAVN
VVDYFINKVSLTFSKNSTEPGDENISLNIQTSNDSFVSLLAVDQSVLMMGASNDINKNLV
SADLKKYIKDDNYCYNCLPNIPRYLGYSDTNSVIDSTGLFVMTNFYRWEPPPPPTWIPWF
PFPMPDYEEGMVMPMMEEQVPVTEAMMMPTMLAEAIPQPTESAKSEVAAPAAPPPVVVRQ
EFPETWIWTDVQSNKNGSYTLNVKVPDTITSWVATGFSVNKIAGLGLSETPAKITVLKPF
FISLELPYSIVRGEEFALQAAVSNYMGMDLEVKVKLLESTYFKVIECGNKTLVNKNITKT
IKVVNNDVSSAYFWLVATSLGQIPIEILAWSGMSADAVKSQLLVKPEGQTQSYSTSTFIQ
LSAGKDFNTSFNITLPPKSILVEGDIIGSTMNNIDNLLQMPYGCGEQTLLNLVPDVFLLK
YLTESGKLTAEFEGKAIGFITSGYQRELTYQRLDGSFSAFGNSDRAGSVWLSSFVIKCFH
QAKKYIPIEDSKIANTMNWIVELQQDDGTFKEPPEGRVIHTDMQVDSEKLALTIKKSTSF
LESQYSLYSSDPYALSIIAYAFFKAGSPKLSDVLSLLDALAIVEGELKYWKKDEDVQKDV
SENVWFRPPYLQAKSSSIELASYVLLVYTQQKNLSKSMPVAKWLLRQRNSLGGFSSTQDT
VLGLEALASFATLIAPSTSSNGITISCKGNTSPNAYLFDKITKETALFLQSYQLPEGTTA
VDISATGEGVALVQLNVEYNVIKENTNKFLNLELSTNRDDKNLHLEISANWTGAEATGMV
LIEINILTGYTFNNELDLRKQIGENLKKIEKSVNKVVLYLDQLTSDNLMFNILLEESLAV
ANVKPALVKIYRYYETGSAVTGFYSPSSGKTWEGACPNCCHRCIAPLWGCIFELAFLRDM
TSTGGAIDFE
Download sequence
Identical sequences T1FFD8
XP_009027053.1.102002 jgi|Helro1|180041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]