SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|184326 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|184326
Domain Number - Region: 185-218
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00955
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|184326
Sequence length 511
Sequence
MTSSSSTSRTTDCKEFCNNDIFEASCPQQLQQQPQQPQQPQQQHLYDYYQMPQQQQQQQQ
QQEQQQHYHNYQPNMVLITKALYGRMTIGGCVKKSYGYVGCYNDVTNHVHRWCSGLTGCS
IRIPDPRLDGTSPCNDEMKSYLDVEYECVYELCQISTFPPDNNPLYLTRQLLSGQPIRKQ
ICGTSEQPWIIIVRPGQRIRVTLLDFSITSTNEITRYNQNLNFNGEQANRTSHSLTSLLA
LPISSSTSSSASPSSSSSFMYQVVPPPPNASAIFDDVSRRLTCDQYVLIEENIVAASSPT
SSSSSSSSSSFSSSSSSSSSSSSSSSLSASKISLLGAPTVKHFMCGNGTQEQTRQYTSQL
HRLQVALLMPPLPSHNYTVRIETGARMDDRRAFSIGAAIMVITLVSFFIGLLVLFAGLLY
LKSFSTYSSDYVKRVIPTRSCALTVYLYRLLRSILTCLCHSSPSFVNLCLLSGSYPLAFK
NAVVSTILINSTLNRNELSSYRPVSNLVFLS
Download sequence
Identical sequences T1FL02
jgi|Helro1|184326 XP_009020439.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]