SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|186652 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|186652
Domain Number 1 Region: 1-217
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 7.06e-65
Family Tubulin, GTPase domain 0.00000868
Further Details:      
 
Domain Number 2 Region: 297-440
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 8.24e-38
Family Tubulin, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|186652
Sequence length 441
Sequence
MTQSIVIQVGQCGNQIGARFWDLALKEHKTLCTKKTSSVDSVNSFFEQVDNERGQTTLKA
RAVLVDMEEGVVDGMTKSNMGSIFKHQQLIKDFSGSGNNWAVGHFEYGGKHDEDLRDCVR
RAVETCDCLQCFFMLHSMGGGTGSGLGTYILKQLEDDYQDVYRFVIPIFPSQDDDVITSP
YNAILALSHLTDHADCVLPIENQALSNIVTKISSSSNKLASRYGKKPQSSSSSLLTSSSS
SSSKMTSLSSSSSSSATRRGCGDGGKDGGLAFDEMNNIVANMILNLTRSSRFDGSLNVDL
NEITMNLVPYPTMHFILSSQSPLLNSSDETGSAKRLDSMFTEAYSPDHQMMTSDPRTGVF
MACALLVRGRVELSDIRRNVDRLKKTLKFVHWNQDGWKTGLCSTPPPHFSHSLLSLSNNS
SLWKNFQDMNGRFLKLYTRKV
Download sequence
Identical sequences T1FP19
jgi|Helro1|186652 XP_009010866.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]