SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188001 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188001
Domain Number 1 Region: 1057-1073,1108-1289,1322-1393
Classification Level Classification E-value
Superfamily Kelch motif 3.27e-27
Family Kelch motif 0.011
Further Details:      
 
Domain Number 2 Region: 839-959
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000419
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 3 Region: 1645-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000628
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188001
Sequence length 2070
Sequence
MAKSNEDKMMKDKNDAALKIQNWFRTLSHKKNIDKQLKINGSFIDIRNEKFSMPISPSFS
LGSKRIEELFAANKIKEQFPLTSNSISQTVNKERKSSNEVNLLYDNKDSNKTFRDVDELE
KISMQSDKTSSSNSDVNVGGQSKNLLSKKHSEIALTSKYLSEEKLGNVITYLKGVKSMGS
TYNVEKNSLISSKSWKKSSQTGVSSNLQDGLKSDNKQTLPRESEMNESNNKSSKEQKKSM
KKQYEETISRHLAFIDQLINDKKGLTEELKRFQDHIQDMTEKFQKELEAREGRHAVELKK
LKDVHAAAEQIKREQWIKTEANRIKELTAKGFEPALQKLIAQHRTEISKLKNLHKEEMKI
CQEDELAKYNKKVEELRKESLKEIAFARKEEREVLEKEFERRLSEEIEAMNKEKENLNSD
LERERRYMEKRLIKQEEEFKKMQSNLNKVHTSAISVLKREFETARNEQEKRHEVLMNNLA
KQYDAEKEEWGKEFFKKHQTEFEEKEKELKNKLKTERDRDIDLVLQNMVDEREKEIRQNK
IDMNNQIKKLKEKHKQELANIETSEKHIYNSYNEIKRYLFAKESENKTLLSQLSQAENII
KELNEAICKRNEEKSKLTDIVRQEVADKMASFESENLKFKQEICNLKAKFKVDVENIQSN
AKQQLKLKEDEVEEVHKRVKEIIEKRVRIENDLKKERDAAVKRADYIQGVLLEQNKSKGK
NRHNDVLVHSLFTINECSSSICGLHGHCVGEQDNNNVPIVQTLSDEIDASIISTTTRDSV
SNTNSSIIASYTDISISSGAKNNETSVDTNLNIMSKVSDVLNLNVYYCKCHEGWYGPTCA
SNKCSGRQWIASRNDSIADGLSNYSDNQRCTWLLGSGDVRTPIYIQFEQFATESNWDYLY
VHDGSSAWEPMVAAISGVVRNSTVARWPELRLTSGYAYIYLITDSAFNSDGFVFYYRWVG
RLVLPCALDDGNNGGGSSPTARCSAHGTAIVTKVQGCVGAKVGGSVSHAPNQPASTCAPI
LTGSVVRTGLVTVPLNIQDLSEGPIKFSSTIEAGQLSVIKNVIYVSGGVVQHPASTNGSG
SGSSDGPDITKSINGSSNSSRSSCSSSSSIMTTNELWSLECEDVCTWRLMNSSDGSEMLS
VSGHTMHAIDGLLYLFFGYNPDVGYLNFVQKFDLATRQWSIIRPSFTSPIVIISGLFGHS
SVLYDASSSSSSSPSPSSSSSGLKLYIHGGFYPSRKSTGKSSDQLFLYDLTDNTWTELRS
SGVQRFMHTSFVLHGHMHVYSGITNYNNTLHRDADDDEINDFMVYDFGCNNGVRLHRYDL
KMASIPYDVLKTDCNVWTTLPAPRFQLATSRSGHSSNVNGERAYTYGGYSGHLLNDLILY
TPAVCRRSRSCDLCLERGCFWCGDRCQSKSVVCHEVQISEMSLCYLVNVNDSFYCSLLPN
CEVCMNDQRCFWSSRGHCLYVASQATKMLPNKNSSSSSSNDDLSTAIITINRFVSNYIIN
PNNTSNRTCPMISCPRFNSCEDCIAVAACMWCSGTRSCLQALGYVPLNLYGSCISWVNEK
PKRCSASTCDYVRTCTECLDNPMCGFCDDGSGTGLGRCVEGGLQGPANHTLATCGSGSGS
TGVVAGGNNNGTGEKSWHFTECPICQCHGHSKCFPGTDKCISCQDNTTGPNCEFCMEGFW
GNAFNGEPCELCSCNGTADSCHQLDGDCHCKTRGAFGKYCDGCEMQVSNLVKHPFDKIGN
SCYEHIIMMGYKVVELNMTEEDSRYFRLANFYFDPLFNKSKDIEIEVTCNPGCNLTVLVK
KGDDIIQIHHHGYSQRSSTSLLQNDFLQHHDWSVDQPSNVTAFLHLYNFTTPLRLTRNKM
EMLEMAKRPFAMCTVLVDEDGEVDQSENVSLISAQASSNSKTDAKHKKIEKLTPVAIEPL
ANQKSAIVSVLVRLPHVDESYALPDQSAFAFASTLVSNGSISRRLALECNGKSKMKPAER
ENYHERQEESRSRLEIRQQLQQQRFHRHLQSLHLQQQRQHNTQQQSQQHSQHHITQQQLQ
QIQEDSQRQHQQQQQQQQLLQQQQPNTTNV
Download sequence
Identical sequences T1FPJ3
jgi|Helro1|188001 XP_009009554.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]